Yfil pseudouridine synthase

Chemistry: molecular biology and microbiology – Enzyme – proenzyme; compositions thereof; process for...

Reexamination Certificate

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

C435S233000, C530S350000, C530S300000, C424S185100, C424S190100

Reexamination Certificate

active

06312932

ABSTRACT:

FIELD OF THE INVENTION
This invention relates to newly identified polynucleotides and polypeptides, and their production and uses, as well as their variants, agonists and antagonists, and their uses. In particular, the invention relates to polynucleotides and polypeptides of the YabO family, as well as their variants, hereinafter referred to as “YfiI pseudouridine synthase,” “YfiI pseudouridine synthase polynucleotide(s),” and “YfiI pseudouridine synthase polypeptide(s)” as the case may be.
BACKGROUND OF THE INVENTION
It is particularly preferred to employ Staphylococcal genes and gene products as targets for the development of antibiotics. The Staphylococci make up a medically important genera of microbes. They are known to produce two types of disease, invasive and toxigenic. Invasive infections are characterized generally by abscess formation effecting both skin surfaces and deep tissues.
S. aureus
is the second leading cause of bacteremia in cancer patients. Osteomyelitis, septic arthritis, septic thrombophlebitis and acute bacterial endocarditis are also relatively common. There are at least three clinical conditions resulting from the toxigenic properties of Staphylococci. The manifestation of these diseases result from the actions of exotoxins as opposed to tissue invasion and bacteremia. These conditions include: Staphylococcal food poisoning, scalded skin syndrome and toxic shock syndrome. The frequency of
Staphylococcus aureus
infections has risen dramatically in the past few decades. This has been attributed to the emergence of multiply antibiotic resistant stains and an increasing population of people with weakened immune systems. It is no longer uncommon to isolate
Staphylococcus aureus
strains which are resistant to some or all of the standard antibiotics. This phenomenon has created an unmet medical need and demand for new anti-microbial agents, vaccines, drug screening methods, and diagnostic tests for this organism.
Moreover, the drug discovery process is currently undergoing a fundamental revolution as it embraces “functional genomics,” that is, high throughput genome- or gene-based biology. This approach is rapidly superseding earlier approaches based on “positional cloning” and other methods. Functional genomics relies heavily on the various tools of bioinformatics to identity gene sequences of potential interest from the many molecular biology databases now available as well as from other sources. There is a continuing and significant need to identify and characterize further genes and other polynucleotides sequences and their related polypeptides, as targets for drug discovery.
Clearly, there exists a need for polynucleotides and polypeptides, such as the YfiI pseudouridine synthase embodiments of the invention, that have a present benefit of, among other things, being useful to screen compounds for anicrobial activity. Such factors are also useful to determine their role in pathogenesis of infection, dysfunction and disease. There is also a need for identification and characterization of such factors and their antagonists and agonists to find ways to prevent, ameliorate or correct such infection, dysfunction and disease.
SUMMARY OF THE INVENTION
The present invention relates to YfiI pseudouridine sythase, in particular YfiI pseudouridine synthase polypeptides and YfiI pseudouridine synthase polynucleotides, recombinant materials and methods for their production. In another aspect, the invention relates to methods for using such polypeptides and polynucleotides, including treatment of microbial diseases, amongst others. In a further aspect, the invention relates to methods for identifying agonists and antagonists using the materials provided by the invention, and for treating microbial infections and conditions associated with such infections with the identified agonist or antagonist compounds. In a still further aspect, the invention relates to diagnostic assays for detecting diseases associated with microbial infections and conditions associated with such infections, such as assays for detecting YfiI pseudouridine synthase expression or activity.
Various changes and modifications within the spirit and scope of the disclosed invention will become readily apparent to those skilled in the art from reading the following descriptions and from reading the other parts of the present disclosure.
DESCRIPTION OF THE INVENTION
The invention relates to YfiI pseudouridine synthase polypeptides and polynucleotides as described in greater detail below. In particular, the invention relates to polypeptides and polynucleotides of a YfiI pseudouridine synthase of
Staphylococcus aureus,
which is related by amino acid sequence homology to
E. coli
YfiI,
B.subtilis
YlyB polypeptide. The invention relates especially to YfiI pseudouridine having the nucleotide and amino acid sequences set out in Table 1 as SEQ ID NO:1 and SEQ ID NO:2 respectively. Note that sequences recited in the Sequence Listing below as “DNA” represent an exemplification of the invention, since those of ordinary skill will recognize that such sequences can be usefully employed in polynucleotides in general, including ribopolynucleotides.
TABLE 1
YfiI pseudouridine synthase Polynucleotide
and Polypeptide Sequences
(A)
Staphylococcus aureus
YfiI pseudouridine synthase polynucleotide
sequence [SEQ ID NO:1].
5′-
TTGGTTATGATTTTCCAATATTTAATATAGCAGATTCAAGTTTAACAATTGGTGTAATATTAATTATTATTG

CCTTATTAAAGGATACTTCCAATAAAAAGGAGAAGGAGGTTAAGTAATGGAGACTTATGAATTTAACATTAC

AGATAAAGAACAAACAGGTATGCGTGTAGATAAGTTGCTGCCTGAATTAAATAATGATTGGTCTCGTAACCA

GATACAAGATTGGATTAAAGCAGGTTTAGTCGTTGCAAACGATAAAGTTGTTAAATCTAATTATAAAGTGAA

ACTTAATGATCATATAGTTGTCACTGAAAAAGAAGTGGTTGAAGCTGACATTCTACCTGAAAATTTAAATTT

AGATATTTATTATGAAGATGATGACGTTGCAGTTGTATATAAACCGAAAGGCATGGTAGTTCATCCATCACC

AGGTCATTATACCAATACATTAGTTAATGGTTTAATGTATCAAATTAAAGATTTATCGGGTATTAATGGAGA

AATTCGTCCAGGTATTGTTCACCGTATAGATATGGATACTTCTGGTTTATTAATGGTTGCTAAAAATGATAT

TGCTCATCGTGGGCTTGTAGAACAATTAATGGATAAATCTGTTAAAAGAAAATATATCGCTTTAGTTCACGG

GAATATTCCTCATGATTACGGTACAATCGATGCGCCAATTGGTAGAAACAAAAATGATCGTCAATCTATGGC

TGTTGTTGATGATGGTAAGGAAGCAGTGACACATTTTAACGTACTAGAACATTTTAAAGATTATACGCTTGT

TGAATGTCAACTTGAAACAGGACGTACGCATCAAATCCGTGTGCACATGAAATATATTGGCTTCCCATTAGT

TGGTGATCCAAAGTATGGACCGAAAAAGACATTGGATATTGGTGGTCAAGCTCTACATGCTGGACTTATTGG

ATTCGACCATCCAGTAACAGGTGAATATATTGAAAGACATGCTGAAATACCACAAGACTTTGAAGATTTATT

AGATACAATTCGAAAAAGAGATGCATAATTGTGTCGTGCTATAATTACGATAACATTATTATGTAAACTATA

AGTATTTATCGTTTTCGTTTTTTAAAAATGAAAACACATTATAAAATAGATTAAGGTTAACATTTTTACTGA

GAATGGNTATTTTCATATAGATTGACAAAGCGCCTGATTAGTATTATCCCCTATACCAGTTAAGTACCACCA

TTAAGGGCTTTAATTGAGCGTCCAGAGAGACGTCAAGACATG-3′

(B)
Staphylococcus aureus
YfiI pseudouridine synthase polypeptide
sequence deduced from a polynucleotide sequence in this table
[SEQ ID NO:2].
NH
2
-
METYEFNITDKEQTGMRVDKLLPELNNDWSRNQIQDWIKAGLVVANDKVVKSNYKVKLNDHIVVTEKEVVEA

DILPENLNLDIYYEDDDVAVVYKPKGMVVHPSPGHYTNTLVNGLMYQIKDLSGINGEIRPGIVHRIDMDTSG

LLMVAKNDIAHRGLVEQLMDKSVKRKYIALVHGNIPHDYGTIDAPIGRNKNDRQSMAVVDDGKEAVTHFNVL

EHFKDYTLVECQLETGRTHQIRVHMKYIGFPLVGDPKYGPKKTLDIGGQALHAGLIGFDHPVTGEYIERHAE

IPQDFEDLLDTIRKRDA-COOH
Deposited materials
A deposit containing a
Staphylococcus aureus
WCUH 29 strain has been deposited with the National Collections of Industrial and Marine Bacteria Ltd. (herein “NCIMB”), 23 St. Machar Drive, Aberdeen AB2 1RY, Scotland on Sep. 11, 1995 and assigned NCIMB Deposit No. 40771, and referred to as
Staphylococcus aureus
WCUH29 on deposit. The
Staphylococcus aureus
stain deposit is referred to herein as “the deposited strain” or as “the DNA of the deposited strain.”
The deposited strain contains a fill length YfiI pseudouridine synthase gene. The sequence of the polynucleotides contained in the deposited strain, as well as the amino acid sequence of any polypeptide encoded thereby, are controlling in the event of any conflict with any description of sequences herein.
The deposit of the deposited strain has been made under the terms of the Budapest Treaty on the International Recogn

LandOfFree

Say what you really think

Search LandOfFree.com for the USA inventors and patents. Rate them and share your experience with other people.

Rating

Yfil pseudouridine synthase does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Yfil pseudouridine synthase, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Yfil pseudouridine synthase will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFUS-PAI-O-2615863

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.