Chemistry: molecular biology and microbiology – Spore forming or isolating process
Patent
1990-09-19
1991-11-19
Doll, John
Chemistry: molecular biology and microbiology
Spore forming or isolating process
4352401, 514 12, 514 21, 514822, 530324, 530856, C12N 508, A61K 3702, C07K 710, C07K 1508
Patent
active
050665928
ABSTRACT:
Trigramin, a 72-amino acid polypeptide, has the following amino acid sequence: EAGEDCDCGSPANPCCDAATCKLIPGAQCGEGLCCDQCSFIEEGTVCRIARGDDLDDYCNGRSAGCPRNPFH. The molecule is a potent inhibitor of fibrinogen binding to receptors expressed on the glycoprotein IIb/IIIa complex in the membrane of platelets. Trigramin is thus a potent inhibitor of fibrinogen-induced human platelet aggregation. It is useful in inhibiting the formation of hemostatic platelet plugs.
REFERENCES:
patent: 4683291 (1987-07-01), Zimmerman et al.
Ouyang et al., "Potent Platelet Aggregation Inhibitor from Trimeresurus gramineus Snake Venom", Biochim. Biophys. Acta., 757:332-341 (1983).
Huang et al., "Action Mechanism of the Potent Platelet Aggregation Inhibitor from Trimeresurus gramineus Snake Venom", Thrombos. Res. 33:125-138 (1984).
Huang et al., "Isolation and Characterization of Trigramin, A Highly Specific Inhibitor of Fibrinogen Binding to Glycoprotein IIb/IIIa Complex on the Platelet Surface", Blood:68 (5), Suppl. 1, p. 318, Abs. #1149 (Nov. 1986).
Huang et al., "Characterization of Fibrinogen Receptors Associated with Glycoprotein IIb/II (GP IIb/GPIII) Complex by Trigramin . . . ", Federation Proceedings 46 (4), Abstract #5819 (Mar. 5, 1987).
Huang et al., "Characterization of Fibrogen Receptors Associated with Glycoprotein IIb/III (GP IIb/GP III) Complex by Trigramin . . . ", Thromb. Haemostas. 58 (1), 196, Abstract #724 (Jul. 6, 1987).
C. Ouyang et al., "Inhibition of Platelet Aggregation by 5-Nucleotidase Purified from Trimeresurus-Gramineus Snake Venom", Toxicon, vol. 21, No. 4, pp. 491-501 (1983).
C. Ouyang et al., "A Potent Platelet Aggregation Inhibitor Purified from Akistrodon-Halys (Mamushi) Snake Venom", Toxicon, vol. 21, No. 6, pp. 797-804 (1983).
C. Ouyang et al., "A Potent Platelet Aggregation Inducer from Trimeresuru Gramineus Snake Venom", Biochimica et Biophysica Acta, vol. 761, pp. 126-134 (1983).
T. Huang et al., "Mechanism of Action of the Platelet Aggregation Inhibito Purified from Agkistrodon-Halys (Mamushi) Snake Venom", Toxicon, vol. 22, No. 2, pp. 243-251 (1984).
C. Ouyang et al., "Effect of the Purified Phospholipases-A.sub.2 from Snake and Bee Venoms on Rabbit Platelet Function", Toxicon, vol. 22, No. 5, pp. 705-718 (1984).
C. Ouyang et al., "Characterization of the Platelet Aggregation Inducer and Inhibitor from Echis-Carinatus Snake Venom", Biochima et Biophysica Acta, vol. 841, pp. 1-7 (1985).
C. Teng et al., "Action Mechanism of the Platelet Aggregation Inducer and Inhibitor from Echis-Carinatus Snake Venom", Biochimica et Biophysica Acta, vol. 841, pp. 8-14 (1985).
Y. Li et al., "A Platelet Function Inhibitor Purified from Vipera Russell Siamensis (Smith) Snake Venom", Toxicon, vol. 23, No. 6, pp. 895-903 (1985).
O. Ouyang et al., "Inhibition of Rabbit Platelet Aggregation by alpha-Fibrinogen Purified from Calloselasma Rhodostoma (Malayan Pit Viper) Venom", J. Formosan Med. Assoc. 84, pp. 1197-1206 (1985).
T. Kosugi et al., "Isolation of Platelet Aggregation Inhibitor from Trimeresurus Flavoviridis Snake Venom", The Snake, vol. 17, pp. 117-123 (1985).
Y. Li et al., "Mechanism of Action of the Platelet Function Inhibitor from Vipera Russelli Siamensis Snake Venom", Toxicon, vol. 24, No. 9, pp. 875-883 (1986).
C. Ouyang et al., "Platelet Aggregation Inhibitors from Agkistrodon Acutus Snake Venom", Toxicon, vol. 24, Nos. 11-12, pp. 1099-1106 (1986).
Huang et al., "Characterization of a Potent Platelet Aggregation Inhibitor from Agkistrodon Rhodostoma Snake Venom", Biochimica et Biophysica Acta, vol. 925, pp. 248-257 (1987).
Joubert et al., "Pr
Holt John C.
Huang Tur-Fu
Lukasiewicz Hanna
Niewiarowski Stefan
Chan Christina
Doll John
Temple University Of The Commonwealth System Of Higher Education
LandOfFree
Trigramin - a platelet aggregation inhibiting polypeptide does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Trigramin - a platelet aggregation inhibiting polypeptide, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Trigramin - a platelet aggregation inhibiting polypeptide will most certainly appreciate the feedback.
Profile ID: LFUS-PAI-O-1369857