Serum tumor marker in rodent prostate cancer models

Details Serum tumor marker in rodent prostate cancer models Serum tumor marker in rodent prostate cancer models

2006-04-28

2010-06-08

Yaen, Christopher H (Department: 1643)

Chemistry: natural resins or derivatives; peptides or proteins;

Peptides of 3 to 100 amino acid residues

Reexamination Certificate

active

07732564

ABSTRACT:
The present invention relates to a rodent serum marker for prostate cancer comprising b-microseminoprotein (PSP94) and diagnostic methods thereof. The present invention also relates to a recombinant sequence to raise a ligand of a specific binding affinity to a rodent serum marker for prostate cancer, which comprises the following amino acid sequence:(SEQ ID NO: 1)MGGSHHHHHHGMASMTGGGGMGRNTRYDDDDKDRWGSWVCSIENREIFPNQMSDDCMDADGNKHFLNTPKKNCTWCSCDKTSITCCTNATPLSYDKDNCDVQFHPENCTYSVVDRKNPGKTCRVDSWTM.

REFERENCES:
Kwong et al (Prostate. Feb 15, 2000;42(3):219-29.
Hara, M. And Kimura, H., J Lab.Clin.Med, 113: 541-548, 1989.
Abrahamsson, P.-A. et al., The prostate, 12: 39-46, 1988.
Hyakutake, H. et al., The prostate, 22: 347-355, 1993.
Grande, M. et al., Clin. Cancer Res., 6: 1790-1795, 2000.
Stege, R. et al., Clin. Cancer Res., 6: 160-165, 2000.
Xuan, J.W. et al., DNA Cell Biol, 18: 11-26, 1999.
Gabril, M. Y. et al., Gene Therapy, 9: 1589-1599, 2002.
Imasato, Y. et al., J.Urol., 164: 1819-1824, 2000.
Bauman, G. S. et al., Prostate J, 2: 94-101, 2000.
Thota, A. et al., J.Cell Biochem., 88: 999-1011, 2003.
Hara, M and Kimura, H., J Lab.Clin.Med, 113:541-548, 1989.
Abrahamsson, P.-A. et al., The prostate, 12:39-46, 1988.
Hyakutake, H. et al., The prostate, 22:347-355, 1993.
Imasato, Y. et al., Prostate J., 2: 94-101, 2000.

Affiliated with

Also associated with

Rating

Serum tumor marker in rodent prostate cancer models does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Serum tumor marker in rodent prostate cancer models, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Serum tumor marker in rodent prostate cancer models will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFUS-PAI-O-4246032