Proteins and novel peptides derived from autoantigen for use in

Drug – bio-affecting and body treating compositions – Antigen – epitope – or other immunospecific immunoeffector – Amino acid sequence disclosed in whole or in part; or...

Patent

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

424535, 424548, 514 2, 514 21, 514825, 530350, 530395, A61K 3900, A61K 3520, A61K 3532, A61K 3800

Patent

active

058434496

ABSTRACT:
The present invention relates to novel peptides derived from the autoantigen HC gp-39, said peptides comprising at least one of the amino acid sequences FGRSFTILAS (SEQ ID No. 1), FTLASSETG (SEQ ID No. 2), YDDQESVKS (SEQ ID No. 3) and FSKIASNTQ (SEQ ID No. 4). The peptides resemble MHC Class II restricted T-cell epitopes present on the autoantigen HC gp-39 in articular cartilage. HC gp-39, proteins comprising an amino acid sequence which exhibits at least 50% homology with the amino acid sequence YKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISND (SEQ ID No: 10) and said peptides can be used in antigen-specific treatment of articular cartilage destruction in autoimmune diseases in mammals to induce systemic tolerance of the immune system. The autoantigen HC gp-39, proteins comprising an amino acid sequence which exhibits at least 50% homology with the amino acid sequence YKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISND (SEQ ID NO: 10) and said peptides are also suitable to induce arthritis in animals, preferably mice. The invention furthermore relates to pharmaceutical compositions comprising said autoantigen and/or said peptides, a diagnostic method for the detection of autoreactive T cells in a test sample and test kits to be used in said method.

REFERENCES:
patent: 4284623 (1981-08-01), Beck
Rejman, JJ and Hurley, WL. Biochem. Biophys. Res. Comm. 150(1): 329-334, Jan. 15, 1988.
Shackelton, LM et al., J. Biol. Chem. 270(22): 13076-13083, Jun. 2, 1995.
Hakala, BE et al. J. Biol. Chem. 268(34): 25803-25810, Dec. 5, 1993.
Sendai, et al. Biol. Reprod. 50: 927-934, 1994.
VandenBroek, MF et al. Eur. J. Immunol. 22: 57-61, Jan. 1992.
Nyirkos, P and Golds EE. Biochem. J. 268: 265-268, 1990.
Tisch, R and McDevitt HO. Proc. Nat. Acad. Sci. (USA). 91-437-438, Jan. 1994.

LandOfFree

Say what you really think

Search LandOfFree.com for the USA inventors and patents. Rate them and share your experience with other people.

Rating

Proteins and novel peptides derived from autoantigen for use in does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Proteins and novel peptides derived from autoantigen for use in , we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Proteins and novel peptides derived from autoantigen for use in will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFUS-PAI-O-2393520

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.