Drug – bio-affecting and body treating compositions – Antigen – epitope – or other immunospecific immunoeffector – Amino acid sequence disclosed in whole or in part; or...
Patent
1996-04-18
1998-12-01
Saunders, David
Drug, bio-affecting and body treating compositions
Antigen, epitope, or other immunospecific immunoeffector
Amino acid sequence disclosed in whole or in part; or...
424535, 424548, 514 2, 514 21, 514825, 530350, 530395, A61K 3900, A61K 3520, A61K 3532, A61K 3800
Patent
active
058434496
ABSTRACT:
The present invention relates to novel peptides derived from the autoantigen HC gp-39, said peptides comprising at least one of the amino acid sequences FGRSFTILAS (SEQ ID No. 1), FTLASSETG (SEQ ID No. 2), YDDQESVKS (SEQ ID No. 3) and FSKIASNTQ (SEQ ID No. 4). The peptides resemble MHC Class II restricted T-cell epitopes present on the autoantigen HC gp-39 in articular cartilage. HC gp-39, proteins comprising an amino acid sequence which exhibits at least 50% homology with the amino acid sequence YKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISND (SEQ ID No: 10) and said peptides can be used in antigen-specific treatment of articular cartilage destruction in autoimmune diseases in mammals to induce systemic tolerance of the immune system. The autoantigen HC gp-39, proteins comprising an amino acid sequence which exhibits at least 50% homology with the amino acid sequence YKLVCYYTSWSQYREGDGSCFPDALDRFLCTHIIYSFANISND (SEQ ID NO: 10) and said peptides are also suitable to induce arthritis in animals, preferably mice. The invention furthermore relates to pharmaceutical compositions comprising said autoantigen and/or said peptides, a diagnostic method for the detection of autoreactive T cells in a test sample and test kits to be used in said method.
REFERENCES:
patent: 4284623 (1981-08-01), Beck
Rejman, JJ and Hurley, WL. Biochem. Biophys. Res. Comm. 150(1): 329-334, Jan. 15, 1988.
Shackelton, LM et al., J. Biol. Chem. 270(22): 13076-13083, Jun. 2, 1995.
Hakala, BE et al. J. Biol. Chem. 268(34): 25803-25810, Dec. 5, 1993.
Sendai, et al. Biol. Reprod. 50: 927-934, 1994.
VandenBroek, MF et al. Eur. J. Immunol. 22: 57-61, Jan. 1992.
Nyirkos, P and Golds EE. Biochem. J. 268: 265-268, 1990.
Tisch, R and McDevitt HO. Proc. Nat. Acad. Sci. (USA). 91-437-438, Jan. 1994.
Boots Anna Maria Helena
Bos Ebo Sybren
Verheijden Gijsbertus Franciscus Maria
Akzo Nobel N.V.
Gormley Mary E.
Saunders David
VanderVegt F. Pierre
LandOfFree
Proteins and novel peptides derived from autoantigen for use in does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Proteins and novel peptides derived from autoantigen for use in , we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Proteins and novel peptides derived from autoantigen for use in will most certainly appreciate the feedback.
Profile ID: LFUS-PAI-O-2393520