Chemistry: natural resins or derivatives; peptides or proteins; – Peptides of 3 to 100 amino acid residues – 25 or more amino acid residues in defined sequence
Reexamination Certificate
2006-02-07
2006-02-07
Chan, Christina (Department: 1644)
Chemistry: natural resins or derivatives; peptides or proteins;
Peptides of 3 to 100 amino acid residues
25 or more amino acid residues in defined sequence
C514S012200, C424S194100, C424S185100
Reexamination Certificate
active
06995237
ABSTRACT:
Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
REFERENCES:
patent: 5652342 (1997-07-01), Zimmerman et al.
patent: 5869270 (1999-02-01), Rhode et al.
Joffre, O et al. Immunobiology [2004] 103(11):4216-4221.
Weiss, E. in Fundamental Immunology 2nd Edition [1989], ed. by W.E. Paul Raven Press, New York. pp. 359-384.
Cel-Sci Corporation
Chan Christina
Sherman & Shalloway
VanderVegt F. Pierre
LandOfFree
Preparation and composition of peptides useful for treatment... does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Preparation and composition of peptides useful for treatment..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Preparation and composition of peptides useful for treatment... will most certainly appreciate the feedback.
Profile ID: LFUS-PAI-O-3686564