Preparation and composition of peptides useful for treatment...

Chemistry: natural resins or derivatives; peptides or proteins; – Peptides of 3 to 100 amino acid residues – 25 or more amino acid residues in defined sequence

Reexamination Certificate

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

C514S012200, C424S194100, C424S185100

Reexamination Certificate

active

06995237

ABSTRACT:
Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.

REFERENCES:
patent: 5652342 (1997-07-01), Zimmerman et al.
patent: 5869270 (1999-02-01), Rhode et al.
Joffre, O et al. Immunobiology [2004] 103(11):4216-4221.
Weiss, E. in Fundamental Immunology 2nd Edition [1989], ed. by W.E. Paul Raven Press, New York. pp. 359-384.

LandOfFree

Say what you really think

Search LandOfFree.com for the USA inventors and patents. Rate them and share your experience with other people.

Rating

Preparation and composition of peptides useful for treatment... does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Preparation and composition of peptides useful for treatment..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Preparation and composition of peptides useful for treatment... will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFUS-PAI-O-3686564

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.