Peptides responsive to antibodies against consensus peptide...

Drug – bio-affecting and body treating compositions – Antigen – epitope – or other immunospecific immunoeffector – Bacterium or component thereof or substance produced by said...

Reexamination Certificate

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

C424S242100, C424S241100, C424S234100, C424S190100, C424S184100, C514S002600, C530S300000, C530S825000

Reexamination Certificate

active

10754642

ABSTRACT:
This invention relates to amino acid sequences from within a consensus peptide of the formula:VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA(SEQ ID. NO: 1)Eight mer peptides from within the consensus peptide were tested against an antibody raised to the consensus peptide. Studies relating to antibody raised to denatured proteins from the natural organisms producing the family of proteins were also useful and showed particular value of some sequences. A sequence of the formula ASVDPTIDLLQA (SEQ ID NO: 2) was identified thereby. An enlarge sequence of the formula TVTASVDPTIDLLQAD (SEQ ID NO: 3) is also especially interesting as are intermediate sequences such as sequences VTASVDPTIDLLQAD (SEQ ID NO: 4), TASVDPTIDLLQAD (SEQ ID NO: 5), and TASVDPTIDLLQA (SEQ ID NO: 6) as being binding sites for antibodies raised to the denatured proteins.

REFERENCES:
patent: 5914114 (1999-06-01), Cassels
patent: WO 92/01703 (1992-02-01), None
patent: WO 92/14487 (1992-09-01), None
patent: WO 92/19263 (1992-11-01), None
patent: WO 96/38171 (1996-12-01), None
patent: WO 9805687 (1998-02-01), None
Karjalainen et al. (1989) “Molecular Cloning and Nucleotide Sequence of the Colonization Factor Antigen I Gene ofEscherichia coli” Infect. And Immun. 57(4):1126-1130.
Sommerfelt et al. (1992) “Genetic Relationship of Putative Colonization Factor O166 to Colonization Factor Antigen I and Coli Surface Antigen 4 of EnterotoxigenicEscherichia coli” Infect. And Immun. 60(9):3799-3806.
Cassels, et al. (1997) “Antibody to N-Terminal Consensus Peptide is Cross-Reactive with All Six Members of the EnterotoxigenicE. coliCFA/I Family” Cytokines, Cholera, and the Gut, 275-279.
Rudin and Svennerholm (1996) “Identification of a Cross-Reactive Continuous B-Cell Epitope in EnterotoxigenicEscherichia coliColonization Factor Antigen I” Infection and Immunity 64(11):4508-4513.
Rudin, et al. (1994) “Monoclonal Antibodies against EnterotoxigenicEscherichia coliColonization Factor Antigen I (CFA/I) that Cross-React Immunologically with Heterologous CFAs” Infection and Immunity 62(10):4339-4346.
Cassels, et al. (1992) “Analysis ofEscherichia coliColonization Factor Antigen I Linear B-Cell Epitopes, as Determined by Primate Responses, Following Protein Sequence Verification” Infection and Immunity 60:2174-2181.
Communication from the EPO providing search results.

LandOfFree

Say what you really think

Search LandOfFree.com for the USA inventors and patents. Rate them and share your experience with other people.

Rating

Peptides responsive to antibodies against consensus peptide... does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Peptides responsive to antibodies against consensus peptide..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Peptides responsive to antibodies against consensus peptide... will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFUS-PAI-O-3928209

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.