Drug – bio-affecting and body treating compositions – Antigen – epitope – or other immunospecific immunoeffector – Bacterium or component thereof or substance produced by said...
Reexamination Certificate
2008-07-29
2008-07-29
Devi, S. (Department: 1645)
Drug, bio-affecting and body treating compositions
Antigen, epitope, or other immunospecific immunoeffector
Bacterium or component thereof or substance produced by said...
C424S242100, C424S241100, C424S234100, C424S190100, C424S184100, C514S002600, C530S300000, C530S825000
Reexamination Certificate
active
07404961
ABSTRACT:
This invention relates to amino acid sequences from within a consensus peptide of the formula:VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA(SEQ ID. NO: 1)Eight mer peptides from within the consensus peptide were tested against an antibody raised to the consensus peptide. Studies relating to antibody raised to denatured proteins from the natural organisms producing the family of proteins were also useful and showed particular value of some sequences. A sequence of the formula ASVDPTIDLLQA (SEQ ID NO: 2) was identified thereby. An enlarge sequence of the formula TVTASVDPTIDLLQAD (SEQ ID NO: 3) is also especially interesting as are intermediate sequences such as sequences VTASVDPTIDLLQAD (SEQ ID NO: 4), TASVDPTIDLLQAD (SEQ ID NO: 5), and TASVDPTIDLLQA (SEQ ID NO: 6) as being binding sites for antibodies raised to the denatured proteins.
REFERENCES:
patent: 5914114 (1999-06-01), Cassels
patent: WO 92/01703 (1992-02-01), None
patent: WO 92/14487 (1992-09-01), None
patent: WO 92/19263 (1992-11-01), None
patent: WO 96/38171 (1996-12-01), None
patent: WO 9805687 (1998-02-01), None
Karjalainen et al. (1989) “Molecular Cloning and Nucleotide Sequence of the Colonization Factor Antigen I Gene ofEscherichia coli” Infect. And Immun. 57(4):1126-1130.
Sommerfelt et al. (1992) “Genetic Relationship of Putative Colonization Factor O166 to Colonization Factor Antigen I and Coli Surface Antigen 4 of EnterotoxigenicEscherichia coli” Infect. And Immun. 60(9):3799-3806.
Cassels, et al. (1997) “Antibody to N-Terminal Consensus Peptide is Cross-Reactive with All Six Members of the EnterotoxigenicE. coliCFA/I Family” Cytokines, Cholera, and the Gut, 275-279.
Rudin and Svennerholm (1996) “Identification of a Cross-Reactive Continuous B-Cell Epitope in EnterotoxigenicEscherichia coliColonization Factor Antigen I” Infection and Immunity 64(11):4508-4513.
Rudin, et al. (1994) “Monoclonal Antibodies against EnterotoxigenicEscherichia coliColonization Factor Antigen I (CFA/I) that Cross-React Immunologically with Heterologous CFAs” Infection and Immunity 62(10):4339-4346.
Cassels, et al. (1992) “Analysis ofEscherichia coliColonization Factor Antigen I Linear B-Cell Epitopes, as Determined by Primate Responses, Following Protein Sequence Verification” Infection and Immunity 60:2174-2181.
Communication from the EPO providing search results.
Cassels Frederick J.
Loomis-Price Lawrence
Arwine Elizabeth
Devi S.
The United States of America as represented by the Secretary of
LandOfFree
Peptides responsive to antibodies against consensus peptide... does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Peptides responsive to antibodies against consensus peptide..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Peptides responsive to antibodies against consensus peptide... will most certainly appreciate the feedback.
Profile ID: LFUS-PAI-O-2769054