Mutations associated with iron disorders

Chemistry: molecular biology and microbiology – Measuring or testing process involving enzymes or... – Involving nucleic acid

Reexamination Certificate

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

C536S022100

Reexamination Certificate

active

06355425

ABSTRACT:

BACKGROUND OF THE INVENTION
Hemochromatosis is the most common progressive (and sometimes fatal) genetic disease in people of European descent. Hemochromatosis is a disease state characterized by an inappropriate increase in intestinal iron absorption. The increase can result in deposition of iron in organs such as the liver, pancreas, heart, and pituitary. Such iron deposition can lead to tissue damage and functional impairment of the organs.
In some populations, 60-100% of cases are attributable to homozygosity for a missense mutation at C282Y in the Histocompatibility iron (Fe) loading (HFE) gene, a major histocompatibility (MHC) non-classical class I gene located on chromosome 6p. Some patients are compound heterozygotes for C282Y and another mutation at H63D.
SUMMARY OF THE INVENTION
The invention is based on the discovery of novel mutations which are associated with aberrant iron metabolims, absorption, or storage, or in advanced cases, clinical hemochromatosis. Accordingly, the invention features a method of diagnosing an iron disorder, e.g., hemochromatosis or a genetic susceptibility to developing such a disorder, in a mammal by determining the presence of a mutation in exon 2 of an HFE nucleic acid. The mutation is not a C→G missense mutation at position 187 of SEQ ID NO:1 which leads to a H63D substitution. The nucleic acid is an RNA or DNA molecule in a biological sample taken from the mammal, e.g. a human patient, to be tested. The presence of the mutation is indicative of the disorder or a genetic susceptibility to developing it. An iron disorder is characterized by an aberrant serum iron level, ferritin level, or percent saturation of transferrin compared to the level associated with a normal control individual. An iron overload disorder is characterized by abnormally high iron absorption compared to a normal control individual. Clinical hemochromatosis is defined by an elevated fasting transferrin saturation level of greater than 45% saturation.
For example, the mutation is a missense mutation at nucleotide 314 of SEQ ID NO:1 such as 314C which leads to the expression of mutant HFE gene product with amino acid substitution I105T. The I105 T mutation is located in the &agr;1 helix of the HFE protein and participates in a hydrophobic pocket (the “F” pocket). The alpha helix structure of the &agr;1 domain spans residues S80 to N108, inclusive. The I105T mutation is associated with an iron overload disorder.
TABLE 1
Human HFE cDNA sequence
 atgggccg cgagccaggc

cggcgcttct cctcctgatg cttttgcaga ccgcggtcct gcaggggcgc ttgctgcgtt

cacactctct gcactacctc ttcatgggtg cctcagagca ggaccttggt ctttccttgt

ttgaagcttt gggctacgtg gatgaccagc tgttcgtgtt ctatgat
cat
gag
agt
cgcc
                                                   H63D    S65C
gtgtggagcc ccgaactcca tgggtttcca gtagaatttc aagccagatg tggctgcagc

tgagtcagag tctgaaa
ggg
 tgggatcaca tgttcactgt tgacttctgg act
att
atgg
                  G93R                                    I105T
aaaatcacaa ccacagcaag gagtcccaca ccctgcaggt catcctgggc tgtgaaatgc

aagaagacaa cagtaccgag ggctactgga agtacgggta tgatgggcag gaccaccttg

aattctgccc tgacacactg gattggagag cagcagaacc cagggcctgg cccaccaagc

tggagtggga aaggcacaag attcgggcca ggcagaacag ggcctacctg gagagggact

gccctgcaca gctgcagcag ttgctggagc tggggagagg tgttttggac caacaagtgc

ctcctttggt gaaggtgaca catcatgtga cctcttcagt gaccactcta cggtgtcggg

ccttgaacta ctacccccag aacatcacca tgaagtggct gaaggataag cagccaatgg

atgccaagga gttcgaacct aaagacgtat tgcccaatgg ggatgggacc taccagggct

ggataacctt ggctgtaccc cctggggaag agcagagata tacgtgccag gtggagcacc

caggcctgga tcagcccctc attgtgatct gggagccctc accgtctggc accctagtca

ttggagtcat cagtggaatt gctgtttttg tcgtcatctt gttcattgga attttgttca

taatattaag gaagaggcag ggttcaagag gagccatggg gcactacgtc ttagctgaac

gtgagtgaca cgcagcctgc agactcactg tgggaaggag acaaaactag agactcaaag

agggagtgca tttatgagct cttcatgttt caggagagag ttgaacctaa acatagaaat

tgcctgacga actccttgat tttagccttc tctgttcatt tcctcaaaaa gatttcccca

tttaggtttc tgagttcctg catgccggtg atccctagct gtgacctctc ccctggaact

gtctctcatg aacctcaagc tgcatctaga ggcttccttc atttcctccg tcacctcaga

gacatacacc tatgtcattt catttcctat ttttggaaga ggactcctta aatttggggg

acttacatga ttcattttaa catctgagaa aagctttgaa ccctgggacg tggctagtca

taaccttacc agatttttac acatgtatct atgcattttc tggacccgtt caacttttcc

tttgaatcct ctctctgtgt tacccagtaa ctcatctgtc accaagcctt ggggattctt

ccatctgatt gtgatgtgag ttgcacagct atgaaggctg tgcactgcac gaatggaaga

ggcacctgtc ccagaaaaag catcatggct atctgtgggt agtatgatgg gtgtttttag

caggtaggag gcaaatatct tgaaaggggt tgtgaagagg tgttttttct aattggcatg

aaggtgtcat cacgatttgc aaagtttaat ggtgccttca tttgggatgc tactctagta

ttccagacct gaagaatcac aataattttc tacctggtct ctccttgttc tgataatgaa

aattatgata aggatgataa aagcacttac ttcgtgtccg actcttctga gcacctactt

acatgcatta ctgcatgcac ttcttacaat aatttatga gataggtact attatccccca

tttctttttt aaatgaagaa agtgaagtag gccgggcacg gtggctcgcg cctgtggtcc

cagggtgctg agattgcagg tgtgagccac cctgcccagc cgtcaaaaga gtcttaatat

atatatccag atggcatgtg tttactttat gttactacat gcacttggct gcataaatgt

ggtacaacca ttctgtcttg aagggcaggt gcttcaggat accatataca gctcagaagt

ttcttcttta ggcattaaat tttagcaaag atatctcatc tcttctttta aaccattttc

tttttttgtg gttagaaaag ttatgtagaa aaaagtaaat gtgatttacg ctcattgtag

aaaagctata aaatgaatac aattaaagct gttatttaat tagccagtga aaaactatta

acaacttgtc tattacctgt tagtattatt gttgcattaa aaatgcatat actttaataa

atgtacattg tattgtaaaa aaaaaaa
(SEQ ID NO:1l GENBANK® Accession No. U60319)
TABLE 2
Human HFE gene product
MGPRARPALLLLMLLQTAVLQG

RLLRSHSLHYLFMGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSISSQ


MWLQLSQSLKGWDHMFTVDFWTIMENHNHSK
ESHTLQVILGCEMQEDNSTEGYWKYGYDG

QDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVL

DQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKEFEPKDVLPNGDG

TYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPSPSGTLVIGVISGIAVFVVILFI

GILFIILRKRQGSRGAMGHYVLAERE (SEQ ID NO: 2; GENBANK ® Accession

No. U60319)
Residues 1-22=leader sequence; &agr;1 domain underlined; residues 63, 65, 93, and 105 indicated in bold type)
Other mutations include nucleotide 277 of SEQ ID NO:1, e.g., 277C which leads to expression of mutant HFE gene product G93R and one at nucleotide 193 of SEQ ID NO:1, e.g., 193T, which leads to expression of mutant HFE gene product S65C.
Any biological sample containing an HFE nucleic acid or gene product is suitable for the diagnostic methods described herein. For example, the biological sample to be analyzed is whole blood, cord blood, serum, saliva, buccal tissue, plasma, effusions, ascites, urine, stool, semen, liver tissue, kidney tissue, cervical tissue, cells in amniotic fluid, cerebrospinal fluid, hair or tears. Prenatal testing can be done using methods used in the art, e.g., amniocentesis or chorionic villa sampling. Preferably, the biological sample is one that can be non-invasively obtained, e.g., cells in saliva or from hair follicles.
The assay is also used to screen individuals prior to donating blood to blood banks and to test organ tissue, e.g., a donor liver, prior to transplantation into a recipient patient. Both donors and recipients are screened.
In some cases, a nucleic acid is amplified prior to detecting a mutation. The nucleic acid is amplified using a first oligonucleotide primer which is 5′ to exon 2 and a second oligonucleotide primer is 3′ to exon 2. To detect mutation at nucleotide 314 of SEQ ID NO:1, a first oligonucleotide primer which is 5′ to nucleotide 314 and a second oligonucleotide primer which is

LandOfFree

Say what you really think

Search LandOfFree.com for the USA inventors and patents. Rate them and share your experience with other people.

Rating

Mutations associated with iron disorders does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Mutations associated with iron disorders, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Mutations associated with iron disorders will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFUS-PAI-O-2832247

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.