Drug – bio-affecting and body treating compositions – Antigen – epitope – or other immunospecific immunoeffector – Amino acid sequence disclosed in whole or in part; or...
Patent
1995-05-31
1999-08-03
Adams, Donald E.
Drug, bio-affecting and body treating compositions
Antigen, epitope, or other immunospecific immunoeffector
Amino acid sequence disclosed in whole or in part; or...
4242081, 530324, A61K 3921, A61K 3800, C07K 500
Patent
active
059322187
ABSTRACT:
This invention is directed toward a multideterminant human immunodeficiency virus type 1 (HIV-1) peptide which comprises a covalently linked T-helper (Th) lymphocyte epitope, cytotoxic T-lymphocyte (CTL) epitope, and an epitope capable of eliciting a neutralizing antibody response (AbN), wherein said peptide has the following amino acid sequence: KQIINMWQEVGKAMYAPPISGQIRRIHIGPGRAFYTTKN. This peptide has the further characteristic of evoking all three of these immune responses in hosts having a broad range of major histocompatibility complex (MHC) types. This peptide is useful as an immunogen to generate broad immune responses in a host, to assess immune responses in virally infected hosts, and as a diagnostic reagent to detect viral infection.
REFERENCES:
Lasarte et al., Cellular Immunology, vol. 141: 211-218 (1992).
Defoort et al., Proc. Natl. Acad. Sci., vol. 89: 3879-3883 (1992).
Shrier et al., Journal of Virology, vol. 62, No. 8: 2531-2536 (1988).
Rovinski et al., Journal of Virology, vol. 66, No. 7: 4003-4012 (1992).
Greenstein et al., Journal of Immunology, vol. 148: 3970-3977.
Palker et al., Journal of Immunology, vol. 142: 3612-3619 (1989).
Sarobe, P. et al., 1991, Ehr. J. Immumol. vol. 21: 1555-1558.
Berzofsky, J.A., et al., 1991, J. Clin. Invest. vol. 88: 876-884.
Hart et al., Proc. Natl. Acad. Sci., vol. 88: 9448-9452 (1991).
Hart et al., Journal of Immunology, vol. 145: 2677-2685 (1990).
J.D. Ahlers et al., J. Immonology, vol. 150: 5647-5665 (1993).
K. Javaherian et al., Proc. Natl. Acad. Sci., vol. 86: 6768-6772 (1989).
Eisenlohr et al., "Flanking Sequences Influence the Presentation of an Endogenously Synthesized Peptide to Cytotoxic T Lymphocytes", J. Exp. Med. 175:481-487, 1992.
Sharma et al., "Co-dominant and Reciprocal T-helper Cell Activity of Epitopic Sequences and Formations of Junctional B-cell Determinants in Sythetic T:B Chimeric Immunogens", vaccine 11(13): 1321-1326, 1993.
Engelhard, 1994, Ann. Rev. Immunol. 12:181-207.
Graham and Wright, 1995, New Engl. J. Med. 333:1331-1339.
Haynes, 1993, Science 260:1279-1286.
Ahlers Jeffrey D.
Berzofsky Jay A.
Nara Peter
Pendelton C. David
Shirai Mutsunori
Adams Donald E.
Parkin Jeffrey S.
The United States of America as represented by the Department of
LandOfFree
Multideterminant peptides eliciting helper T-lymphocyte, cytotox does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Multideterminant peptides eliciting helper T-lymphocyte, cytotox, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Multideterminant peptides eliciting helper T-lymphocyte, cytotox will most certainly appreciate the feedback.
Profile ID: LFUS-PAI-O-847456