Multideterminant peptides eliciting helper T-lymphocyte, cytotox

Drug – bio-affecting and body treating compositions – Antigen – epitope – or other immunospecific immunoeffector – Amino acid sequence disclosed in whole or in part; or...

Patent

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

4242081, 530324, A61K 3921, A61K 3800, C07K 500

Patent

active

059322187

ABSTRACT:
This invention is directed toward a multideterminant human immunodeficiency virus type 1 (HIV-1) peptide which comprises a covalently linked T-helper (Th) lymphocyte epitope, cytotoxic T-lymphocyte (CTL) epitope, and an epitope capable of eliciting a neutralizing antibody response (AbN), wherein said peptide has the following amino acid sequence: KQIINMWQEVGKAMYAPPISGQIRRIHIGPGRAFYTTKN. This peptide has the further characteristic of evoking all three of these immune responses in hosts having a broad range of major histocompatibility complex (MHC) types. This peptide is useful as an immunogen to generate broad immune responses in a host, to assess immune responses in virally infected hosts, and as a diagnostic reagent to detect viral infection.

REFERENCES:
Lasarte et al., Cellular Immunology, vol. 141: 211-218 (1992).
Defoort et al., Proc. Natl. Acad. Sci., vol. 89: 3879-3883 (1992).
Shrier et al., Journal of Virology, vol. 62, No. 8: 2531-2536 (1988).
Rovinski et al., Journal of Virology, vol. 66, No. 7: 4003-4012 (1992).
Greenstein et al., Journal of Immunology, vol. 148: 3970-3977.
Palker et al., Journal of Immunology, vol. 142: 3612-3619 (1989).
Sarobe, P. et al., 1991, Ehr. J. Immumol. vol. 21: 1555-1558.
Berzofsky, J.A., et al., 1991, J. Clin. Invest. vol. 88: 876-884.
Hart et al., Proc. Natl. Acad. Sci., vol. 88: 9448-9452 (1991).
Hart et al., Journal of Immunology, vol. 145: 2677-2685 (1990).
J.D. Ahlers et al., J. Immonology, vol. 150: 5647-5665 (1993).
K. Javaherian et al., Proc. Natl. Acad. Sci., vol. 86: 6768-6772 (1989).
Eisenlohr et al., "Flanking Sequences Influence the Presentation of an Endogenously Synthesized Peptide to Cytotoxic T Lymphocytes", J. Exp. Med. 175:481-487, 1992.
Sharma et al., "Co-dominant and Reciprocal T-helper Cell Activity of Epitopic Sequences and Formations of Junctional B-cell Determinants in Sythetic T:B Chimeric Immunogens", vaccine 11(13): 1321-1326, 1993.
Engelhard, 1994, Ann. Rev. Immunol. 12:181-207.
Graham and Wright, 1995, New Engl. J. Med. 333:1331-1339.
Haynes, 1993, Science 260:1279-1286.

LandOfFree

Say what you really think

Search LandOfFree.com for the USA inventors and patents. Rate them and share your experience with other people.

Rating

Multideterminant peptides eliciting helper T-lymphocyte, cytotox does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Multideterminant peptides eliciting helper T-lymphocyte, cytotox, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Multideterminant peptides eliciting helper T-lymphocyte, cytotox will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFUS-PAI-O-847456

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.