Chemistry: natural resins or derivatives; peptides or proteins; – Proteins – i.e. – more than 100 amino acid residues – Blood proteins or globulins – e.g. – proteoglycans – platelet...
Reexamination Certificate
2006-08-22
2006-08-22
Devi, S. (Department: 1645)
Chemistry: natural resins or derivatives; peptides or proteins;
Proteins, i.e., more than 100 amino acid residues
Blood proteins or globulins, e.g., proteoglycans, platelet...
C530S388200, C530S388100, C530S387900, C530S350000, C530S300000, C424S139100, C424S141100, C424S150100, C424S130100, C424S164100
Reexamination Certificate
active
07094883
ABSTRACT:
A monoclonal antibody to a consensus peptide of the formula:VEKKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID NO. 1) is described.The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO. 2) and has use as a diagnostic and for prophylaxis against illness arising fromE. coliwhich produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.
REFERENCES:
patent: 5914114 (1999-06-01), Cassels
patent: 6045799 (2000-04-01), Reeves et al.
patent: WO 9638171 (1996-12-01), None
Cassels Frederick
Lees Andrew
Schuman Richard
Arwine Elizabeth
Devi S.
Harris Charles H.
Moran John Francis
The United States of America as represented by the Secretary of
LandOfFree
Monoclonal antibody which agglutinates E. coli having the... does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Monoclonal antibody which agglutinates E. coli having the..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Monoclonal antibody which agglutinates E. coli having the... will most certainly appreciate the feedback.
Profile ID: LFUS-PAI-O-3668966