Modified hirudin proteins and T-cell epitopes in hirudin

Details Modified hirudin proteins and T-cell epitopes in hirudin Modified hirudin proteins and T-cell epitopes in hirudin

2004-06-25

2008-09-16

Carlson, Karen Cochrane (Department: 1656)

Drug, bio-affecting and body treating compositions

Designated organic active ingredient containing

Peptide containing doai

C530S300000

Reexamination Certificate

active

07425533

ABSTRACT:
Modified forms of hirudin having improved properties are disclosed. The modified hirudin compounds are hirudin variants comprising amino acid substitutions in the sequence of hirudin. Peptide molecules consisting of the amino acid residue sequence CILGSDGEKNQCVTGEGTPKPESHNDGDFE (SEQ ID NO: 1) or a sequence consisting of at least 9 consecutive amino acid residues of SEQ ID NO: 1 having a potential MHC class II binding activity are disclosed. The peptide has a stimulation index of >1.8 in a biological assay of cellular proliferation, in which the index is defined as the value of cellular proliferation scored following stimulation by the peptide and divided by the value of cellular proliferation scored in control cells that have not been exposed to the peptide.

REFERENCES:
patent: 5256559 (1993-10-01), Maraganore et al.
patent: 5705355 (1998-01-01), Tolstoshev et al.
patent: 0 468 448 (1992-01-01), None
Scharf et al., 1989; Primary structures of new ‘iso-hirudins’. FEBS Letters 255 (1): 105-110.
Schlaeppi et al. 1990; Preparation of monoclonal antibodies to hirudin and hirudin peptides. European Journal of Biochemistry 188: 463: 470.

Affiliated with

Also associated with

Rating

Modified hirudin proteins and T-cell epitopes in hirudin does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Modified hirudin proteins and T-cell epitopes in hirudin, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Modified hirudin proteins and T-cell epitopes in hirudin will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFUS-PAI-O-3983212