Drug – bio-affecting and body treating compositions – Antigen – epitope – or other immunospecific immunoeffector – Amino acid sequence disclosed in whole or in part; or...
Patent
1996-11-15
1999-06-15
Cunningham, Thomas M.
Drug, bio-affecting and body treating compositions
Antigen, epitope, or other immunospecific immunoeffector
Amino acid sequence disclosed in whole or in part; or...
4242681, 530380, 530395, A61K 3800, C07K 14705
Patent
active
059119918
ABSTRACT:
A composition and method for inhibiting binding of malarial Duffy-binding ligand to Duffy blood group antigens on mammalian erythrocytes is disclosed. The composition includes a Duffy-related peptide which interferes with binding between Duffy antigen expressed on erythrocyte cell surfaces and the Duffy-binding ligands of merozoites. Particularly preferred peptides are the peptides having the sequences AELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYD (SEQ ID NO:1) or AELSPSTQNSSQLNSDLWNFSYDGNDSFPDVDYD (SEQ ID NO:4), as well as peptides which comprise either of those sequences in their primary structure, or other peptides having equivalent function. A method is disclosed which comprises administering a Duffy-based peptide which interferes with malarial binding to Duffy antigen in an amount sufficient to inhibit binding of merozoites to erythrocytes.
REFERENCES:
patent: 5101017 (1992-03-01), Rubinstein et al.
patent: 5198347 (1993-03-01), Miller et al.
patent: 5541292 (1996-07-01), Miller et al.
patent: 5578714 (1996-11-01), Pogo et al.
patent: 5614194 (1997-03-01), Colman et al.
Goodman, et al., Methods in Enzymology 68:75-90, 1979.
Broome et al., Biochemistry 75(6):2746-49, 1978.
Nichols, et al., J. Exp. Med. 166:776-785, 1987.
Asok Chaudhuri, Valerie Zbrzezna, Carol Johnson, Margaret Nichols, Pablo Rubenstein, W. Laurence Marsh, and A. Oscar Pogo, "Purification and Characterization of an Erythrocyte Membrane Protein Complex Carrying Duffy Blood Group Antigenicity," (1989) The Journal of Biological Chemistry 264, 13770-13774.
Asok Chaudhuri, Julia Polyakova, Valerie Zbrzezna, Kenneth Williams, Subhash Gulati, and A. Oscar Pogo, "Cloning of Glycoprotein D cDNA, Which Encodes the Major Subunit of the Duffy Blood Group System and the Receptor for the Plasmodium Vivax Malaria Parasite," (1993) Proc. Natl. Acad. Sci. USA 90, 10793-10797.
S. Mathew, A. Chaudhuri, V.V.V.S Murty and A.O. Pogo, "Confirmation of Duffy Blood Group antigen Locus (FY) at 1q22.fwdarw.q23 by Fluorescence in Situ Hybridization," (1994) Cytogenet Cell Genet 67, 68.
Asok Chaudhuri, Valerie Zbrzezna, Julia Polyakova, A. Oscar Pogo, Joseph Hesselgesser, and Richard Horuk, "Expression of the Duffy Antigen in K562 Cells," (1994) The Journal of Biological Chemistry 269, 7835-7838.
Asok Chaudhuri and A. Oscar Pogo, "The Duffy Blood Group System and Malaria," (1995) Blood Cell Biochemistry, Molecular Basis of Major Human Blood Group Antigens 6, 243-265.
Asok Chaudhuri, Julia Polyakova, Valeri Zbrzezna, and A. Oscar Pogo, "The Coding Sequence of Duffy Blood Group Gene in Humans and Simians: Restriction Fragment Length Polymorphism, Antibody and Malarial Parasite Specificities, and Expression in Nonerythroid Tissues in Duffy-Negative Individuals," (1995) Blood 85, 615-621.
A.O. Pogo, A. Chaudhuri, "Duffy and Receptors for P. Vivax and Chemotactic Peptides," (1995) TCB 4, 269-276.
Christophe Tournamille, Yves Colin, Jean Pierre Cartron & Caroline Le Van Kim, "Disruption of a GATA Motif in the Duffy Gene Promoter Abolishes Erythroid Gene Expression in Duffy-Negative Individuals," (1995) Nature Genetics 10, 224-228.
Sadahiko Iwamoto, Toshinori Omni, Eiji Kajii, and Shigenori Ikemoto, "Genomic Organization of the Glycoprotein D Gene: Duffy Blood Group Fy.sup.a /Fy.sup.b Alloantigen System is Associated with a Polymorphism at the 44-Amino Acid Residue" (1995) Blood 85, 622-626.
Sadahiko Iwamoto, Jianping Li, Toshinori Omi, Sigenori Ikemoto, and Eiji Kajii, "Identification of a Novel Exon and Spliced Form of Duffy mRNA That is the Predominant Transcript Both Erythroid and Postcapillary Venule Endothelium" (1996) Blood 87, 378-385.
Chaudhuri Asok
Pogo A. Oscar
Cunningham Thomas M.
New York Blood Center Inc.
LandOfFree
Malarial binding site in duffy blood group protein does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Malarial binding site in duffy blood group protein, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Malarial binding site in duffy blood group protein will most certainly appreciate the feedback.
Profile ID: LFUS-PAI-O-400955