Human galanin, CDNA clones encoding human galanin and a method o

Details Human galanin, CDNA clones encoding human galanin and a method o Human galanin, CDNA clones encoding human galanin and a method o

1995-07-25

1998-05-26

Wax, Robert A.

Drug, bio-affecting and body treating compositions

Designated organic active ingredient containing

Peptide containing doai

536 235, 435 691, 4351723, A61K 3817, C12N 1512, C12P 2102

Patent

active

057564604

ABSTRACT:
The present invention provides a peptide having the amino acid sequence of human galanin. The amino acid sequence of this peptide is: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS (SEQ ID NO: 1). The present invention further provides DNA clones encoding the peptide and to therapeutic uses of the peptide.

REFERENCES:
Young et al. Proc. Nat. Acad. Sci., USA 80: 1194-1198, 1983.
Loche et al. Pediatric Res. 26:316-319, 1989.
Bauer et al. Gastroenterology 91: 877-883, 1986.
Hermansen et al. Acta Endrocrinologica 121:541-550, 1989.
Davis et al. J. Clin. Endocrin. Metab. 65: 1248-1252, 1987.
Fisone et al. Proc. Nat. Acad. Sci. USA 86: 9588-9589, 1988.
Gallwitz et al. Biochem. Biophys. Res. Comm. 172: 268-275, 1990.
Lagny-Pourmir et al. Peptides 10:757-761, 1989.
Vrontakis et al., J. Biol. Chem., 262:35, 1987, pp. 16755-16758.
Rokaeus, et al., Proc. Natl. Acad. Sci. USA, vol. 83, pp. 6287-6291, 1986.
Bersani, et al., FEBS Letters, vol. 283, No. 2, pp. 189-194, 1991.
Rokaeus, et al., FEBS Letters, vol. 234, No. 2, pp. 400-406, 1988.
Schmidt et al., Proc. Natl. Acad. Sci. USA, vol. 88, pp. 11435-11439, 1991.
Ulman, et al., Neuroscience Letters, 136, pp. 105-108, 1992.
Kaplan, et al., Proc. Natl. Acad. Sci. USA, 85, pp. 1065-1069, 1988.

Affiliated with

Also associated with

Rating

Human galanin, CDNA clones encoding human galanin and a method o does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Human galanin, CDNA clones encoding human galanin and a method o, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Human galanin, CDNA clones encoding human galanin and a method o will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFUS-PAI-O-1960075