Human galanin, CDNA clones encoding human galanin and a method o

Drug – bio-affecting and body treating compositions – Designated organic active ingredient containing – Peptide containing doai

Patent

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

536 235, 435 691, 4351723, A61K 3817, C12N 1512, C12P 2102

Patent

active

057564604

ABSTRACT:
The present invention provides a peptide having the amino acid sequence of human galanin. The amino acid sequence of this peptide is: GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS (SEQ ID NO: 1). The present invention further provides DNA clones encoding the peptide and to therapeutic uses of the peptide.

REFERENCES:
Young et al. Proc. Nat. Acad. Sci., USA 80: 1194-1198, 1983.
Loche et al. Pediatric Res. 26:316-319, 1989.
Bauer et al. Gastroenterology 91: 877-883, 1986.
Hermansen et al. Acta Endrocrinologica 121:541-550, 1989.
Davis et al. J. Clin. Endocrin. Metab. 65: 1248-1252, 1987.
Fisone et al. Proc. Nat. Acad. Sci. USA 86: 9588-9589, 1988.
Gallwitz et al. Biochem. Biophys. Res. Comm. 172: 268-275, 1990.
Lagny-Pourmir et al. Peptides 10:757-761, 1989.
Vrontakis et al., J. Biol. Chem., 262:35, 1987, pp. 16755-16758.
Rokaeus, et al., Proc. Natl. Acad. Sci. USA, vol. 83, pp. 6287-6291, 1986.
Bersani, et al., FEBS Letters, vol. 283, No. 2, pp. 189-194, 1991.
Rokaeus, et al., FEBS Letters, vol. 234, No. 2, pp. 400-406, 1988.
Schmidt et al., Proc. Natl. Acad. Sci. USA, vol. 88, pp. 11435-11439, 1991.
Ulman, et al., Neuroscience Letters, 136, pp. 105-108, 1992.
Kaplan, et al., Proc. Natl. Acad. Sci. USA, 85, pp. 1065-1069, 1988.

LandOfFree

Say what you really think

Search LandOfFree.com for the USA inventors and patents. Rate them and share your experience with other people.

Rating

Human galanin, CDNA clones encoding human galanin and a method o does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Human galanin, CDNA clones encoding human galanin and a method o, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Human galanin, CDNA clones encoding human galanin and a method o will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFUS-PAI-O-1960075

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.