Factor XIIIA fibrin binding fragments

Details Factor XIIIA fibrin binding fragments Factor XIIIA fibrin binding fragments

1990-06-22

1994-07-12

Wax, Robert A.

Drug, bio-affecting and body treating compositions

Designated organic active ingredient containing

Peptide containing doai

4351723, 435193, 530350, 530381, 930100, C12N 1554, A61K 3752, A61K 3700, C07K 1300

Patent

active

053288980

ABSTRACT:
Fibrin binding peptides disclosed include (a) peptides having the amino acid sequence of a human Blood Coagulation Factor XIIIA fragment (i.e., NKLIVRRGQSFYVQIDFSRPYDPRRDLFRVEYVIGRYPQENKGTYIPVPIVSELQSGKWGAKIVMREDR SVRLSIQSSPKCIVGKFRMYVAVWTPYGVLRTSRNPETDTYILFNPWCEDDAVYLDNEKEREEYVLNDIGVIFY GEVNDIKTRSWSYGQF-R', where R, is --CONH.sub.2 or --NH.sub.2); (b) peptides which are fragments of the foregoing Factor XIIIA fragment and which retain the capability thereof of binding to fibrin; and (c) peptides which bind to fibrin, which have the amino acid sequence of any of the foregoing peptides, and which have additional amino acid residues attached to the N-terminal end and/or the C-terminal end thereof.
The peptides are useful for localizing blood clots in vivo, inhibiting fibrin stabilization, and promoting thrombolysis.

REFERENCES:
Stryer, L. in Biochemistry, Third edition, p. 22 (1988).
Takahashi et al. (1986) Proc. Natl. Acad. Sci. U.S.A. 83:8019-8023.
Ichinose et al. (1988) Proc. Natl. Acad. Sci. U.S.A. 85:5829-5833.
Grundmann et al. (1986) Proc. Natl. Acad. Sci. U.S.A. 83:8024-8028.
K. Achyuthan et al., "Guinea Pig Liver Transglutaminase and Factor XIII A-Chains are Homologous Fibrin(ogen) Binding Proteins," in Fibrinogen 3: Biochemistry, Biological Functions, Gene Regulation and Expression, 165-69 (M. Mosesson et al. eds.) (1988).
K. Achyuthan et al., "The Binding Sites on Fibrin(ogen) for Guinea Pig Liver Transglutaminase are Similar to Those of Blood Coagulation Factor XIII," J. Biol. Chem. 263, No. 28, 14296 (1988).
C. Greenberg et al., "Regulation of Plasma Factor XIII Binding to Fibrin In Vitro," Blood 66, No. 5, 1028 (1985).
C. Greenberg et al., "Isolation of a Fibrin-Binding Fragment from Blood Coagulation Factor XIII Capable of Cross-Linking Fibrin(ogen)," Biochem. J. 256, 1013 (1988).
A. Ichinose et al., "Amino Acid Sequence of the a Subunit of Human Factor XIII," Biochemistry 25, 6900 (1986).
N. Takahashi et al., "Primary Structure of Blood Coagulation Factor XIIIa (Fibrinoligase, transglutaminase) from Human Placenta," Proc. Natl. Acad. Sci. U.S.A. 83, 8019 (1986).

Affiliated with

Also associated with

Rating

Factor XIIIA fibrin binding fragments does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Factor XIIIA fibrin binding fragments, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Factor XIIIA fibrin binding fragments will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFUS-PAI-O-396503