Biologically active TGF-.beta.2 peptides

Details Biologically active TGF-.beta.2 peptides Biologically active TGF-.beta.2 peptides

1993-01-26

1995-05-30

Draper, Garnette D.

Chemistry: natural resins or derivatives; peptides or proteins;

Peptides of 3 to 100 amino acid residues

25 or more amino acid residues in defined sequence

530399, 930120, A61K 3818

Patent

active

054202434

ABSTRACT:
The invention relates to peptides corresponding to regions of the amino acid sequence of TGF-.beta.1 or TGF-.beta.2 which retain, either in monomeric or polymeric forms, at least some of the biological activity of the respective full length TGF-.beta.. The monomeric form of the peptide derived from TGF-.beta.1 comprises the following amino acid sequence: CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGP (SEQ ID NO: 1). The monomeric form of the peptide derived from TGF-.beta.2 comprises the following amino acid sequence: CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGA (SEQ ID NO: 2). Dimers may be formed via disulfide bonds between the amino-terminal cysteine residues, the carboxy-terminal cysteine residues, or amino- and carboxy-terminal cysteine residues of the monomer subunits.

REFERENCES:
patent: 4806523 (1989-02-01), Bentz et al.
patent: 4822606 (1989-04-01), Snyderman et al.
patent: 5061786 (1991-10-01), Burnier et al.
Tam et al Int J Peptide Protein Res 39:464-71 (1992).
Cianciolo et al Clinical Research 38(2):325A (1990).
Van den Eijnden-VanRaaij et al. J. of Immunol Methods 133:107-118 (1990).
Hazarika et al Life Science 42:252831 (1988).

Affiliated with

Also associated with

Rating

Biologically active TGF-.beta.2 peptides does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Biologically active TGF-.beta.2 peptides, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Biologically active TGF-.beta.2 peptides will most certainly appreciate the feedback.

Rate now

Comments { 0 }

Profile ID: LFUS-PAI-O-362842