Biologically active TGF-.beta.1 peptides

Drug – bio-affecting and body treating compositions – Designated organic active ingredient containing – Peptide containing doai

Patent

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

Other Related Categories

530324, 530399, A61K 3818, C07K 14475, C07K 14495

Type

Patent

Status

active

Patent number

056588836

Description

ABSTRACT:
The invention relates to peptides corresponding to regions of the amino acid sequence of TGF-.beta.1 or TGF-.beta.2 which retain, either in monomeric or polymeric forms, at least some of the biological activity of the respective full length TGF-.beta.. The monomeric form of the peptide derived from TGF-.beta.1 comprises the following amino acid sequence: CVRQLYIDFRKDLGWKWIHEPKGYHANFCLGP (SEQ ID NO: 1). The monomeric form of the peptide derived from TGF-.beta.2 comprises the following amino acid sequence: CLRPLYIDFKRDLGWKWIHEPKGYNANFCAGA (SEQ ID NO: 2). Dimers may be formed via disulfide bonds between the amino-terminal cysteine residues, the carboxy-terminal cysteine residues, or amino- and carboxy-terminal cysteine residues of the monomer subunits.

REFERENCES:
patent: 4806523 (1989-02-01), Bentz et al.
patent: 4822606 (1989-04-01), Snyderman et al.
patent: 5061786 (1991-10-01), Burnier et al.
patent: 5244793 (1993-09-01), Purchio et al.
Derynck, R. et al., NAR, 15(7):3188-3189, 1987.
Tam et al., "Efficient approach to synthesis of two-chain asymmetric cysteine analogs of receptor-binding region of transforming growth factor-.alpha." Int. J. Peptide Protein Res. (1992) 39:464-471.
Cianciolo, "Inhibition of lymphocyte proliferation by a synthetic peptide corresponding to a region of transforming growth factor beta homologous to CKS-17, an immunosuppressive retroviral-related peptide" Clin. Res. (1990) 38:325A.
Van den Eijnden-Van Raaij et al., "Characterization of polyclonal anti-peptide antibodies specific for transforming growth factor .beta..sub.2 " J. Immuno. Meth. (1990) 133:107-118.
Hazarika et al., "Epitope mapping of alpha-transforming growth factor: Evidence of an immunodominant region" Life Sciences (1988) 42:2525-2531.

LandOfFree

Say what you really think

Search LandOfFree.com for the USA inventors and patents. Rate them and share your experience with other people.

Rating

Biologically active TGF-.beta.1 peptides does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Biologically active TGF-.beta.1 peptides, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Biologically active TGF-.beta.1 peptides will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFUS-PAI-O-1104807

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.