Antagonists of chaperonin 10

Drug – bio-affecting and body treating compositions – Immunoglobulin – antiserum – antibody – or antibody fragment,... – Binds antigen or epitope whose amino acid sequence is...

Patent

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

4241411, 4241311, 4241561, 4241741, 5303873, 5303879, 5303887, 530380, 530327, 53038824, C07K 1600, C07K 1618, A61K 39395, A61K 3514

Patent

active

061138991

ABSTRACT:
An antagonist to, or an antibody (Ab) raised against, cpn10 or a recombinant cpn10 with the sequence: GSAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVEAVGSGSKGKGGEIQPVSVKEGDK VLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD is claimed. Also, claimed are: (1) an antagonist or Ab raised against a peptide derived from cpn10, or a peptide with the sequence: Ac-AGQAFRKLPL(C) AGQAFRKFLPLA2 A1AGQAFRKFLPL Ac-A1AGQAFRKFLPL (A1)EKSQGKVLQATA2 A1EKSQGKVLQAT where A1 and A2 are amino acid sequences that may be added to one or both ends of the peptides, and where the peptides may have a single amino acid deletion, addition or substitution; (2) suppressing cellular growth or enhancing immunological activity by admin. of a cpn10 antagonist or anti-cpn10 Ab to a subject; and (3) an assay for measuring anti-cpn10 Ab in a sample by: (a) reacting purified cpn10 with the sample (b) determining the amt. of Ab in the sample by determining the binding between the Ab and cpn10.
USE--The cpn 10 antagonist or Ab can be used to terminate pregnancy, suppressing tumour cell growth or enhancing the immune system.

REFERENCES:
Cavanagh et al., "The Purification of Early-Pregnancy Factor To Homogeneity From Human Platelets and Identification as Caperonin 10", Eur. J. Biochem., vol. 222:551-560, (1994).
Quinn et al., "Effect Of Monoclonal Antibodies To Early Pregnancy Factor (EPF) On The in vivo Growth of Transplantable Murine Tumours", Cancer Immunol. Immunother, vol. 34:265-271, (1992).
Quinn et al., "Monoclonal Anibodies to Early Pregnancy Factor Perturb Tumour Cell Growth", Clin. exp. Immunol., vol. 80:100-108, (1990).
Quinn et al., "Early Pregnancy Factor In Liver Regeneration After Partial Hepatectomy In Rats: Relationship With Chaperonin 10", Hepatology, vol. 20:1294-1302, (1994).
Hartman et al., "Identification Of A Mammalian 10-kDa Heat Shock Protein, A Mitochondrial Chaperonin 10 Homologue Essential For Assisted Folding Of Trimeric Ornithine Transcarbamoylase in vitro", Proc. Natl. Acad. Sci. USA, vol. 89:3394-3398, (1992).
Monzini et al., "Identification And Cloning Of Human Chaperonin 10 Homologue", Biochimica et Biophysica Acta, vol. 1218:478-480, (1994).
Morton et al., "Early Pregnancy Factor", Seminars in Reproductive Endocrinology, vol. 10:72-82, (1992).

LandOfFree

Say what you really think

Search LandOfFree.com for the USA inventors and patents. Rate them and share your experience with other people.

Rating

Antagonists of chaperonin 10 does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with Antagonists of chaperonin 10, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Antagonists of chaperonin 10 will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFUS-PAI-O-2209185

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.