Chemistry: natural resins or derivatives; peptides or proteins; – Peptides of 3 to 100 amino acid residues
Reexamination Certificate
2007-08-14
2007-08-14
Chan, Christina (Department: 1644)
Chemistry: natural resins or derivatives; peptides or proteins;
Peptides of 3 to 100 amino acid residues
C530S324000, C530S325000, C530S326000, C530S327000, C530S328000, C424S185100, C424S810000
Reexamination Certificate
active
11298718
ABSTRACT:
Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.
REFERENCES:
Joffre et al. Immunobiology [2004] 103(11):4216-4221.
Weiss. Fundamental Immunology 2nd Edition [1989], pp. 359-384.
CEL-SCI Corporation
Chan Christina
Hahn & Voight PLLC
VanderVegt F. Pierre
LandOfFree
Methods of preparation and composition of peptide constructs... does not yet have a rating. At this time, there are no reviews or comments for this patent.
If you have personal experience with Methods of preparation and composition of peptide constructs..., we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and Methods of preparation and composition of peptide constructs... will most certainly appreciate the feedback.
Profile ID: LFUS-PAI-O-3832981