SMAD-interacting polypeptides and their use

Drug – bio-affecting and body treating compositions – Designated organic active ingredient containing – Peptide containing doai

Reexamination Certificate

Rate now

  [ 0.00 ] – not rated yet Voters 0   Comments 0

Details

C530S300000, C530S350000

Reexamination Certificate

active

06884779

ABSTRACT:
The current invention concerns SMAD-interacting protein(s) obtainable by a two-hybrid screening assay whereby SMAD1 C-domain fused to GAL4 DNA-binding domain as “bait” and a cDNA library from mouse embryo as “prey” are used. Some characteristics of a specific SMAD-interacting protein (SIP1) of the family of zinc finger/homeodomain proteins including d-crystallin enhancer binding protein and/orDrosophilazfh-1 include an inability to interact with full-size XSMAD1 in yeast, SIP1CZFbinds to E2 box sites, SIP1CZFbinds to the Brachyury protein binding site and interferes with Brachyury-mediated transcription activation in cells and also interacts with the C-domain of SMAD 1, 2 and 5. The minimal length of the amino acid sequence necessary for binding with SMAD appears to be a 51 amino acid domain encompassing amino acids 166-216 of SEQ ID NO: 2 having the amino acid sequence as depicted in the one letter code: QHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKTEDISKLK (SEQ ID NO: 21).

REFERENCES:
Chen et al. Oct. 24, 1996. Nature 383:691-696.*
Laguna et al. Oct. 31, 1996; Nature 383:832-836.*
Zhang et al. Sep. 12, 1996; Nature 383:168-172.*
#Databse Embl Est 16: “Mus musculus cDNA clone 584313 5′ DNA-binding protein”, Accession No. AA125512, Nov. 26, 1996, XP002084026, Compare nucleotides 1-461 of AA125512 with nucleotides 1567-2027 in Seq. ID No.: 1, 1 page.
#Databse Embl Hum1: “Human mRNA for KIAA0150 gene, partial cds.”, Accession No. D63484, Aug. 3, 1996, XP002084022, compare nucleotides 1-2908 of D63484 with nucleotides 38-2952 in Seq. ID No.: 3, 5 pages.
#Databse Embl Emrod: “Mouse Wnt-7b mRNA, completet cds.”, Accession No. M89802, Apr. 3, 1992, XP002084023, cited in the application compare nucleotides 74-529 in M89802 with nucleotides 391-848 in Seq. ID No.:8, 2 pages.
#Databse Embl Est 16: “Stratagene mouse melanoma. Mus musculus cDNA clone 651678 5”, Accession No. AA212269, Feb. 3, 1997, XP002084024, cited in the application Compare nucleotides 1-432 of AA212269 with nucleotides 930-1362 in Seq. ID No.:10, 1 page.
#Databse Embl EMHUM1: “Homo sapiens mRNA for KIAA0569 protein, complete cds.”, Accession No. AB011141, Apr. 10, 1998, XP002084025, compare nucleotides 1250-4249 in AB011141 with nucleotides 8-3007 in Seq. ID No.:1, 4 pages.
#de Caestecker et al., “Characterization of Functional Domains within Smad4/DPC4”,The Journal of Biological Chemistry,vol. 272, No. 21, May 23, 1997, pp. 13690-13696.
#Meersseman et al., “The C-terminal domain of Mad-like signal transducers is sufficient for biological activity in the Xenopus embryo and transcriptional activation”,Mechanisms of Development,61 (1997), pp. 127-140.
#W. French Anderson. Human gene therapy. Nature, 392, S, 25-30, 1998.
#Gencore DB Version 4.5 AC AB011141 US-09-449-285-1, 1998.
#Gencore DB Version 4.5 AC Q14163 US-09-449-285-4, 1995.
#Gencore DB Version 4.5 AC M89802 US-09-449-285-8, 1990.
#Gencore DB Version 4.5 AC E10101 US-09-449-285-10, 1995.
PCT International Search Report, PCT/EP 98/03193, dated Nov. 27, 1998.
PCT International Preliminary Examination Report, PCT/EP 98/03193, dated Sep. 15, 1999.

LandOfFree

Say what you really think

Search LandOfFree.com for the USA inventors and patents. Rate them and share your experience with other people.

Rating

SMAD-interacting polypeptides and their use does not yet have a rating. At this time, there are no reviews or comments for this patent.

If you have personal experience with SMAD-interacting polypeptides and their use, we encourage you to share that experience with our LandOfFree.com community. Your opinion is very important and SMAD-interacting polypeptides and their use will most certainly appreciate the feedback.

Rate now

     

Profile ID: LFUS-PAI-O-3403066

  Search
All data on this website is collected from public sources. Our data reflects the most accurate information available at the time of publication.